PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008236691.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family B3
Protein Properties Length: 316aa    MW: 36170.5 Da    PI: 5.5584
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008236691.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.84.6e-1419108599
                     -..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--.TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLk.egDfvvFkldgrsefelvvk 95 
                     l     ++++++++p kf++++  +++      l+l+d+s  sW+v++  +k++++ +++++GW+eF k+n L  +++++ + ++g++ f   v+
  XP_008236691.1  19 L---AGFNTDCVRIPQKFLKHMleDLS--ARAILKLKDSSDSSWTVTV--NKTREGaVYFKNGWEEFIKDNSLGtDNEMLQIFYEGKMHF--SVR 104
                     4...5567788********77775444..4458***************..8888888****************97788887777777777..888 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f k
  XP_008236691.1 105 IFGK 108
                     8765 PP

2B353.54.2e-172363151699
                     EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                       +p  f +eh  ++ ++++ +l++ +g +W+v++ + ++++++ +++GW +F++an+++ gD+++F+l +r +   +v+++rk
  XP_008236691.1 236 QFIPTAFSREHF-PQGKGFKAILKNAEGGKWTVNC-IPNSPQSHNFSAGWYKFASANQIRIGDTCIFELLSRYQ--IMVHILRK 315
                     579********4.346799****************.6999999*************************987544..59999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.2E-169109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.98312109IPR003340B3 DNA binding domain
SuperFamilySSF1019361.18E-1412110IPR015300DNA-binding pseudobarrel domain
CDDcd100173.06E-1014106No hitNo description
SMARTSM010197.0E-1115109IPR003340B3 DNA binding domain
PfamPF023621.8E-1120107IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-18219315IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-18219315IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.8E-10226316IPR003340B3 DNA binding domain
PfamPF023621.4E-14235315IPR003340B3 DNA binding domain
CDDcd100171.55E-14238314No hitNo description
PROSITE profilePS5086311.984238316IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MVRKISKNEE EKQSFFKLLA GFNTDCVRIP QKFLKHMLED LSARAILKLK DSSDSSWTVT  60
VNKTREGAVY FKNGWEEFIK DNSLGTDNEM LQIFYEGKMH FSVRIFGKNG IERTEELSSS  120
EEEEEDSEDN TSEDLEVDFT KIGSLHNSLA KNTTKRPRGR PRKYPVSSSK PRPSKSCKVE  180
SGEELSSSES IELNEIKEEE EDSEDSTSED LEGVEPEAIK SNFPYFEGII RQTKCQFIPT  240
AFSREHFPQG KGFKAILKNA EGGKWTVNCI PNSPQSHNFS AGWYKFASAN QIRIGDTCIF  300
ELLSRYQIMV HILRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154162KRPRGRPRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236691.10.0PREDICTED: B3 domain-containing protein At5g18090-like
TrEMBLM5W5L11e-109M5W5L1_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14202819
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16210.21e-11B3 family protein